GenomeNet

>cge:100759289 Tgm2; transglutaminase 2, C polypeptide; K05625 transglutaminase 2 [EC:2.3.2.13] (A)
MAEELLLERCDLEIQANGRDHHTADLCHEKLVLRRGQRFRLTLYFVGRGYEASVDSLTFG
AVTGPAPSEETGTKVRFPLSDDVQEGSWTASVLDQRDNVLALQLCTPANAPVGQYRLSLE
VSSGYQGSSYVLGHFILLFNAWCPADDVYLDSEEQRREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDICLMLLDVNPKFLKDSARDCSRRRSPIYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVESWMTRPDLEPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSVHKSINRSL
IVGQKISTKSVGRDEREDITHTYKYPEGSPEEREAFTRANHLNKLAEKEETGVAMRIRVG
ESMNMGNDFDVFAHIGNDTSESRDCHLLLCARTVSYNGVLGPECGTENLNLTLDPFSENT
IPLRILYEKYSECLTESNLIKVRGLLVEPASNSYLLAERDLYLENPEIKIRILGEPKQNR
KLVAEVSLRNPLSEPLNDCIFTVEGAGLTKEQKSVEVPDPVPAGEVGKVRVDFFPTEIGL
HKLVVNFQCDKLKSVKGYRNVIIGPA

BLAST