GenomeNet

>cgi:CGB_L0600C hypothetical protein (A)
MLLIQEDVSMGTEPLPIPISHLSTPIHNFTYITDSQLGHGTPLSLTYPLLPDSAYHKQPS
SSPISSTKSDNSSDVEDVWTCTCASQHESEKEPSLCTAKCGDLCDCVAQFGNFYSSAEPQ
ILNLDALPYNWPLVECSPSCLCGSSCSNRVTQQGVRTPLTIRPTPPKGYGLFYTPSTPQS
LPRGTFISLYAGEYILPSEICSRWSSPFTTDSASDKKRYEEGQGNYILSLRLSDQTIHID
PRWKGNVGRFLNHSCGANCVVHYVKWGGGQGWPRAAIFTNKNIHPEEELTFDYANASGDP
QRALELIQETTEEDTKGRTRCLCRAEQCRGWMPFDETL

BLAST