GenomeNet

>cgi:CGB_L0600C hypothetical protein; K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MLLIQEDVSMGTEPLPIPISHLSTPIHNFTYITDSQLGHGTPLSLTYPLLPDSAYHKQPS
SSPISSTKSDNSSDVEDVWTCTCASQHESEKEPSLCTAKCGDLCDCVAQFGNFYSSAEPQ
ILNLDALPYNWPLVECSPSCLCGSSCSNRVTQQGVRTPLTIRPTPPKGYGLFYTPSTPQS
LPRGTFISLYAGEYILPSEICSRWSSPFTTDSASDKKRYEEGQGNYILSLRLSDQTIHID
PRWKGNVGRFLNHSCGANCVVHYVKWGGGQGWPRAAIFTNKNIHPEEELTFDYANASGDP
QRALELIQETTEEDTKGRTRCLCRAEQCRGWMPFDETL

BLAST