GenomeNet

>cgm:cgp_1756 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) nanH; exo-alpha-sialidase, secreted protein (A)
MLPIWMGLPFKKAGALSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASISE
EPEFSTQQLADGGTLGFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTD
NGATWGEQHDISAGITAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAGYFTSQPGTDPDD
RNVAHVAYAKSSDNGSTWVADTVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPS
VTRMTNGRVAAVAMLSDDHGATWYPSAPWGNSMDENKIVELSDGTLMNNSRSSGADTYRK
VSYSTDGGVTWTEPTLDTQLPDPRNNASLIRVFPTAPEGSAQAKVLLFSNTATTSGRTNG
TVRMSCDDGQTWPVSKVFEPGAIQYTSMATLPNGDIGML

BLAST