GenomeNet

>cgr:CAGL0A04829g K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MVHLGPKKPPTRKGSMVDMPQQLLDQIKVFEEMYTVDGETLRKVTKHFITELDKGLSKKG
GNIPMIPGWVMEYPSGKEKGDYLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKLPEAMRT
TKNHEELWSFIADSLQAFLEDQFPEGVKGKLPLGFTFSYPASQDRINQGVLQRWTKGFDI
PNVEGHDVVPMLQKQIEKRNLPIDIVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDVVSDIPKLEGKLADDIPNDSPMAINCEYGSFDNEHVVLPRNKYDLIIDEESPRPGQQA
FEKMSSGYYLGEMLRLALLDLYDQGLILKGQDISKLKKPYVMDTSYPSKIEDDPFENLED
TDELLQKNLGIQTTVQERKLIRRLCELIGTRSARLSVCGIAAICQKRGYETAHIAADGSV
FKMYPGFKEKAAQGLADIYGWEHKDPKDCPIVIVDAEDGSGAGAAIIAALAEKRIAEGKS
LGVLGA

BLAST