GenomeNet

>cgr:CAGL0E03850g K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) hypothetical protein (A)
MIRRGVLSLGISGRRLMSTEAPRLKTFKIYRWNPDQPEVKPKLQEFKVDLNECGPMVLDA
LLKIKDEQDASLTFRRSCREGICGSCAMNIGGRNTLACLCKIDQDTSKQAKIYPLPHMFI
VKDLVPDLTNFYQQYKSIKPYLQRKDYPADGKEVLQSIEDRKKLDGLYECILCACCSTSC
PSYWWNQEEYLGPAVLMQAYRWLVDSRDQATQERKDMLNNSMSLYRCHTIMNCTKTCPKG
LNPGESIAKIKQQLAF

BLAST