GenomeNet

>cgr:CAGL0E06358g K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] | (RefSeq) hypothetical protein (A)
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSAKGEQEAARAGELLKEKNVHPDILYTSKLSR
AIQTANIALSKADRLWIPVKRSWRLNERHYGALQGKDKAETLETYGEEKFNTWRRSFDVP
PPVIEADSPYSQKNDERYRDVDPNVLPQTESLALVIDRLLPYWEDVIAKDLLAGKTVMIA
AHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAA
VAAQGKK

BLAST