GenomeNet

>cgr:CAGL0H07579g hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MVHLGPKKPPARKGSMVDMPKDLLDEIKKFEDMFSVDAATLQKVTKHFISELSKGLSKEG
GNIPMIPAWVMENPTGKEKGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYKLPGPMRT
TKDPEEIWSFIADSLETFIKEQFPEGCNETLPLGFTFSFPASQDKINQGVLQRWTKGFDI
PNIEGHDVIPMLQKQIEKRNLPIDIVALINDTTGTLVASLYTDGETKMGVIFGTGVNGAY
YDVVSDIPKLEGKLADDIPSSSLMAINCEYGSFDNEHVVLPRNKYDIAIDEESPRPGQQT
FEKMSSGYYLGELLRLALLDLYNQGLIFKGQDVQKLKEAYIMDTSYPSRIEDDPFENLED
TDELFQADLGIQTTVQERKLIRRLCELIGTRSARLSVCGIAAICQKRGYETAHIAADGSV
FNKYPGFQQRAAEGLRDIYGWKEDKPQNYPIVIVAAEDGSGAGAAIIAALAQKRIAEGKS
LGVIGA

BLAST