GenomeNet

>cgr:CAGL0J06974g hypothetical protein; K11484 histone deacetylase HOS3 [EC:3.5.1.98] (A)
MDDPLSKFFQQFQLFVQNNPNVISAARAAAQIPESAKAVIVLSPYSLSHEFSRDWVAKSY
KKTIVERPERLLAAAMGVAAAITMYPALFTLKSSHRRQSSLLSPHVLKVHGSEWPRTLLQ
LCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISN
RVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKYGVTHAVILDFDLHHGDGTQDLC
WKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCI
MNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFKGLVV
ISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKAIT
SGVFSHLIGLQNQDWINEWGSEQVVKEIVRGCKPSWKPYKTKKARDVIRIWAEEVIRLGR
AMIPEFEDILFKEGLQSNPGLGDVPTSTIAQRLRKTHVKEEPTKTKELTEPPKTSTNTRK
SRNDDTKKDVPFIQQELSSEDEGEDEDYVYDEELNKTFNRTVEDITIDDISRHLETLELE
QIDENEPQELFIKKDENKQQRHLQSNGMYKIPSSKTQRFKNSQQPQSNSPPTYDDSDISM
ISHVSVARKHNTRSGRKW

BLAST