GenomeNet

>cgr:CAGL0J06974g K11484 histone deacetylase HOS3 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MDDPLSKFFQQFQLFVQNNPNVISAARAAAQIPESAKAVIVLSPYSLSHEFSRDWVAKSY
KKTIVERPERLLAAAMGVAAAITMYPALFTLKSSHRRQSSLLSPHVLKVHGSEWPRTLLQ
LCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISN
RVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKYGVTHAVILDFDLHHGDGTQDLC
WKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSFPTESGFATKENIKNASTCI
MNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFKGLVV
ISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKAIT
SGVFSHLIGLQNQDWINEWGSEQVVKEIVRGCKPSWKPYKTKKARDVIRIWAEEVIRLGR
AMIPEFEDILFKEGLQSNPGLGDVPTSTIAQRLRKTHVKEEPTKTKELTEPPKTSTNTRK
SRNDDTKKDVPFIQQELSSEDEGEDEDYVYDEELNKTFNRTVEDITIDDISRHLETLELE
QIDENEPQELFIKKDENKQQRHLQSNGMYKIPSSKTQRFKNSQQPQSNSPPTYDDSDISM
ISHVSVARKHNTRSGRKW

BLAST