GenomeNet

>cgr:CAGL0K10626g K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) hypothetical protein (A)
MPRDLQNHLLFEVATEVANKVGGIYSVLKSKAPVTVAQYQDNYTLIGPLNKGTYQGEVEE
LDWEDPSIFSEELQPVQQALKYMREKGVYFVYARWLIEGAPRVILFDLDSVRYKLNEWKA
DLWSLVGIPSPENDWETNDAILLGYTVVWFLGELTQLDHKHAIIGHFHEWLAGVALPLCR
KKRIDVVTIFTTHATLLGRYLCAAGDVDFYNHLQYFDVDQEAGKRGIYHRYCIERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKEKINDFVRAH
FHGNFDFDLDNTLYFFIAGRYEYKNKGADMFVEALARLNYRLKMAGSKKTVVAFIIMPAQ
NNSFTVEALRSQAVVKSLENTVNEVTSLIGKRIFEHAMKFPHNGITNEIPNNLEELLKPS
DKVLLKKRVLALRRPYGELPPIVTHNMADDANDPILNQIRHVQLFNNHSDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETNQAKDYGIYIVDRRYKAPDESVEQLVDYMEEFVNKTRRQRINQRNRTERLSDLLDWK
RMGLEYVKARQLGLRRAYPDQFKEIVGEDVNDSSMEALAGGKKLKIARPLSVPGSPRDAA
KSPSTVFMTPGDLGTIQDANNVDDYFHLSVNDNEEE

BLAST