GenomeNet

>cgt:cgR_1608 hypothetical protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASIGEEPEFSTQQLADGGTL
GFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTDNGATWGEQHDISAGI
TAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAGYFTSQPGTDPDDRNVAHVAYAKSSDNG
STWVADTVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPSVTRMTNGRVAAVAML
SDDHGTTWYPSAPWGNSMDENKIVELSDGTLMNNSRSSGADTYRKVSYSTDGGVTWTEPT
LDTQLPDPRNNASLIRVFPTAPEGSAQAKVLLFSNTATTSGRTNGTVRMSCDDGQTWPVS
KVFEPGAIQYTSMATLPNGDIGMLWENSGSNIDIFYSQFNLSWLEAGCIGVDADETPVTA
GETTTMNVTLTNPFANAIFDRAVSLELPEGWQAEDVRVSIPSGESVTIPVQVTAPLVADN
GELPVEVSILDGADRYTGRLNLTVQGGQEPASTSVKVSIPNLKDTYVAGEKISINFAVNN
PFDVTVNSVPSLGEGENWMPANLRGFDPEQGAPNCRYRNLGANQSYNCTTTTYEVSDSDV
ERGYVDIPTVWTFTNSAGETVWSKNVDVPRIELNGTQDAVTDAIVTVDPINPVHSNGQSQ
TVEVQANVTSEGDLPAGSKVAFYLDSSPIDAAAVDAEGHASISIDVDNIASEQPERTFEV
RARLVVPEDAPRSIARDALARFTVLPEQVQQNSLVIMNHPDVVSDGQTKTIVIAVKATAH
DGSPVAIGTLITFRVNGIERDVVPTNAQGTAKLQLDLKPVNTEDEEYEVTVEAELDELTA
QTTFKVLAGEEEEPTSTEEQPSETEQPSEPEEEPTAPTGSSNGGSFAALLALLAALGGIV
GAVLGLLKL

BLAST