GenomeNet

>cgt:cgR_1633 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) hypothetical protein (A)
MTDFLRDDIRFLGRILGEVIAEQEGQEVYELVEQARLTSFDIAKGNAEMDSLVQVFDGIT
PAKATPIARAFSHFALLANLAEDLHDEELREQALDAGDTPPDSTLDATWLKLNEGNVGAE
AVADVLRNAEVAPVLTAHPTETRRRTVFDAQKWITTHMRERHALQSAEPTARTQSKLDEI
EKNIRRRITILWQTALIRVARPRIEDEIEVGLRYYKLSLLEEIPRINRDVAVELRERFGE
DVPLKPVVKPGSWIGGDHDGNPYVTAETVEYSTHRAAETVLKYYARQLHSLEHELSLSDR
MNKVTPQLLALADAGHNDVPSRVDEPYRRAVHGVRGRILATTAELIGEDAVEGVWFKVFT
PYASPEEFLNDALTIDHSLRESNDTLIADDRLSVLISAIESFGFNLYSLDLRQNSESYED
VLTELFERAQVTANYRELSEEEKLEVLLKELRSPRPLIPHGSDEYSEVTDRELGIFRTAS
EAVKKFGPRMVPHCIISMASSVTDVLEPMVLLLKEFGLIAANGDNPRGTVDVIPLFETIE
DLRAGAGILGELWKIDLYRNYLLQRDNVQEVMLGYSDSNKDGGYFSANWALYDAELQLVE
LCRSAGVKLRLFHGRGGTVGRGGGPSYDAILAQPKGAVQGSVRITEQGEIISAKYGNPET
ARRNLEALVSATLEASLLDVSELTDHQRAYDIMSEISELSLKKYTSLVHEDQGFIDYFTQ
STPLQEIGSLNIGSRPSSRKQTSSVEDLRAIPWVLSWSQSRVMLPGWFGVGTALEQWIGE
GEQATQRIAELQTLNESWPFFTSVLDNMAQVMSKAELRLAKLYADLIPDREVAERVYSVI
HEEYFLTKKMFCVITGSDDLLDDNPLLARSVQRRYPYLLPLNVIQVEMMRRYRKGDQSEQ
VSRNIQLTMNGLSTALRNSG

BLAST