GenomeNet

>cgu:WA5_1495 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) NanH; hypothetical protein (A)
MLPIWMGLPFKKAGALSRRKAVFSALGAAALIGAALPTIPTAQAQTPTGYGFDATASISE
EPEFSTQQLADGGTLGFDCYRIPSLGVAPNGNVLASWDGRPNNCSDAPQPNSIVGKVSTD
NGATWGEQHDISAGITAEPKTGYSDPSIVVDWERGDVFNFHVKSFDAEYFTSQPGTDPDD
RNVAHVAYAKSSDNGSTWVADTVITDQVVADDTWDSRFATSGNGIQLQYGAYKGRLVQPS
VTRMTNGRVAAVAMLSDDHGATWYPSAPWGNSMDENKIVELSDGTLMNNSRSSGADTYRK
VSYSTDGGVTWTEPTLDTQLPDPRNNASLIRVFPTAPEGSAQAKVLLFSNTATTSGRTNG
TVRMSCDDGQTWPVSKVFEPGAIQYTSMATLPNGDIGML

BLAST