GenomeNet

>chd:Calhy_1814 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein (A)
MAIRDRLSGNEAVAFAMKQINPDVVAAFPITPSTEVPQYFSQYVANGEVDTEFVAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDELVKKFVGEYNPEFYLLNEQNPISMGPLDLPPYYFEHKRQQAEAMKNAKKVVLEVA
EEFAALTGRKYGLFEAYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVDEIVGALKHLKAVAIMDKSDGFNAAGGPLFTEITSALYGRAEGIKAINYIYGLGGRD
VKTDDIAKVYDRLLDIVKTGNVGEVYNYIGVRE

BLAST