GenomeNet

>che:CAHE_0047 pdhC; dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12); K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] (A)
MAECIRMPKMSDTMEYGIVSRWIKQVGDKVVAGDILAEVDTDKATMELESYEDGTLLYVG
VAERAAARINDIIAIIGDPEEDINTLLASTVAIDGDRPADTRIDLPLPIVDDQPVVPTAH
MQSHLPLERSIASPLAKKIAKEKGYDLSQIQGSGEAGRIIKKDVIHFVPNRLDQFSISEQ
STRTAYQDFPISAMRQKIAEVLTESKMNIPHFYLTVDINMNKLVEIRAELNQYASTKISI
NDLIIKATALALIQHPKVNAAWLTDKIRSYQYVHIGVAVAVEDGLMVPVVRFADQKPLVQ
ISKTVKILSKQAQQKTLTPKDYTGATFTISNLGMFGITSFSAIINPPAACILAIGAMQQI
PIFKDNQVVPAHMLQLTLSCDHRVVDGHAGALFLATLKTLLEQPLSLLL

BLAST