GenomeNet

>chn:A605_13280 hypothetical protein; K01113 alkaline phosphatase D [EC:3.1.3.1] (A)
MTQDGKRGLSRRGLLRGILALGATATIPSSINRVHASNHQVLADAEPVGLHEPAPGEHGV
FMHGVASGDPLPTSVILWTRVTPDPAAVLGSGLGPAVRVGWEVATTENFATTVRSGTVTA
TAAEDHTVHVDPFGLEPGTVYFFRFTVLDGGHAGHVSRTGRTRTAPADDAEPDALRLAVC
SCANYESGYFGAYSDIARRAVAGEIDVVVHMGDYLYEYASGEYPGKHGIIRPHVPTWGIR
TLADYRSRYGHYRRDAELQAAHAAAPWVVTWDDHEIANDAWSGGAENHGDLDGDWSTRRD
AAMQAYLEWLPVRGTSPSRGGRIYRTLRFGRLAELHMLDLRSYRSAPGVLHAARRTSTER
TIMGSEQFSWLSARLATASARWNLIGTSVMMAPLNLLALEEMVLDPVIELLGLDLAGTPV
NADQWDGYAVDRARLLSQLLDQHPHGRTVFLTGDIHSEWASHIEHAGRIVAAELVCTSVS
ASNIDDMLRLSEDNPVSRGAETHMLRHNPHISHVELDAHGYSVLDVRHDGVEMSWHRVAD
ITVAGAPMHAGPTLRYDGARLRETRSDESARTNRGSLNAAPGSR

BLAST