GenomeNet

>chu:CHU_0801 K07405 alpha-amylase [EC:3.2.1.1] | (GenBank) a-amylase, glycoside hydrolase family 57 protein (A)
MRSVTLCFQVHQPFRINPYTFFDIGKNHSYEDAAHNKLVVDRVADLCYLPTNKILLQQIK
KYKGLFRVAFSISGTTIEQFKLYRPDVIDSFIALAKTDCVEFLAETYYHSLSSIFSKEEF
LIQVDTHRKLIRSTFGYQTEVFRNTELIHNNDIAATIKELGLKGMITEGVQKLLGTMSTN
KVYSPAHTSFPVILRNCKLSDDLAFRFSDKNWKGYPLTVEKYTSWIKKSLKKHENATIYV
DYETFGEHQKKNSGIFTFLRKLPGMLIDTHGIDFMTPSEVIDNLEIHDVYDAHETISWAD
IEKNLSAWYQNSMQKEALEKIYSLEPLIRKMQIRRHTDKWSKLQTSDHFYYMSTKGYSDG
EVHQYFSPFASPHDAYIHYMNVVADFELEIRKKKLFK

BLAST