GenomeNet

>chu:CHU_0959 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) amyA; a-glycosidase, glycoside hydrolase family 13 protein (A)
MNSIKDVDLSEITAGKKYWNVERPVEEEVMYFLLIDRFHDGKERISIPSTTGFGNTDQLQ
ARCGGTIQGVIKNLKYISALGFTSIWINPFLQNNPETYHGYSIENFLEVDAQWGTKEDIV
ELVAQAHKLHIKVFFDIVLNHTGNNWSYVKENPRYNKGKQYAVKAWRYPDRPIPAELRNL
NLYGRKGGIVKWEETPETWDGDIFELKDLIQDDSEIGHATLEILIAVYSYWFAVTDCDGF
RIDAAKHIPPKWLNTFVDAMKALTASVHKTSFFIFAEIISNQSYISKYHTIDGYLDFDFH
FSFVPNMYGEKKRKSAIQSQPRPVDKVPIRFLDNHDQVGQMPKHRIAYRMKEKALCNLLR
AFLCMPGIPCIYYGTEQGLKGKGILDGSIRECLFNPDGKEDILNLDSPYARVIKEGIHLR
KKLNLYTGDFQSCEIMAAKSHRCIALQVNGLASSKLIVYNLGPHNEVVSIKLSSPLTRTN
KLVVYLYSNGDADNDDKTVVNDILHNITMHPYGFKVLELLNHQESVN

BLAST