GenomeNet

>chu:CHU_2837 ATP-dependent DNA ligase (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MALETYKEKRNFKHTPEPVAKKNAAGTELKFVIQRHAASHLHYDFRLEMEGVLKSWAVPK
GPSLNPSDKRLAMMVEDHPFAYRTFHGVIPEGNYGAGIVEIWDEGTYHAIGNEDRKTGEK
ELLADLKKGNLKFVLHGKKLKGEFALVKIKNNNSSKDNAWLLIKHKDAYATEDAYSSEDY
VPANSKIVKKTAASKKPATPVSKKSAIKMVDDKPATDKKKVQSAPAQKIKQGKDPMPHEV
KPMLAKLKDAPFDSPEWIFEIKWDGYRAIAEIDQGKVELYSRNLISFTKKYKPIVESLQS
FGHNVVLDGEVIVLNADGTSSFQMLQQYDETPSPDLCYCVFDILFLDGRDLRDLPLLERK
AILKKVIPDLPNLKYSDHVEKEGIRFFELAKKNKLEGIMAKRADSIYRLGSRSDQWIKLK
IVKSQEAIICGFTAPRNSRKDFGALILGAYENGRLVYIGHTGGGFTMALLASTLKLMKPL
IQKESPFDVKIKTNEKVTWIKPKLVCAIAFSEWTSDGHMRQPIFQGMRIDKKVSEVTREL
PTVINVPQDNAMEVTRNIKQTAAKTSTKKTAHKKAASKKTTTNKKTTDVAAAENSKAGEF
KIDGQVLKISNRSKVYWPEDGYTKGDLIDYYMQAADYILPYLKDRPESLNRHPNGIDGSS
FFQKDMGDTLPDWIEAKEIFSESNSKDINYVLCQNKATLIYMANLGCIEINPWNSRVKKI
EYPDFIVIDLDPSDNNTFDEVIETALVVKKILDKGGIDAYCKTSGATGLHIYIPLGAKYT
YEQGKNFAHIIAQLTNNELPELTSLVRNPKERKKQIYVDYLQNRGGQTLAAPYSVRPKPG
ATVSTPLEWKEVKKGLHPSTFTIKTIFKRLEKKGDLFKGVLGKGIDMEKCLKKLGA

BLAST