GenomeNet

>chy:CHY_0025 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) conserved hypothetical protein (A)
MDLSKIITNPDKLFYPADLIFKKDVIAYYYLMADHILPYISNRPFVMNRFPDGIAGKSFY
QKEIPAYAPNFLNKVAIWHEKEKKWVNYPYVAHKEALLWLVNQGVIELHCWLSEVPQIEN
PDILVFDLDPEPPLSFQDCLPVALLLREVLLKLGLEAWPKTSGKEGMHLFVPIEPKYGFK
DTTRAAFNLCRLILKAYPEKVTLERVIKKRTGKVYLDYLQNSRGRTMVFPYSLRPLPKAP
VSTPLLWEEVTKGEISPAEFNIKTIWERVKKYGDLWSNFHRRRYDIKPLLELM

BLAST