GenomeNet

>chy:CHY_0264 K01905 acetate---CoA ligase (ADP-forming) subunit alpha [EC:6.2.1.13] K22224 acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13] | (GenBank) acetyl-CoA synthase (A)
MEALKIAPTEKFKERVAKLLNPRSIAVIGASEKPEKLGNAILRNIVSGYKGEVFGVNPRV
KKIQEIEVYPDVFSLPYPVDLAVIVLPAEKAVVALKEAAEAGVKSAVVISGGFKETGNEG
ALLEEEIKKIALDFEMPVLGPNCVGIVNNNLQLNATFLRTAPLKGEIAFVSQSGAILSTV
LEWSLKEDLGFSYMISMGNKAVLNEADFLPAIANDPGTAVILLYIEDVVEGSSFLKKAYE
ASLLKPVVVFKAGISTAGAKAASSHTGALAGSIEGYKLAFAKTGLIRAKTLEEMFIYARV
FASGQKVTGKNIGIVTNSGGPGVITADRLELNGLNITGLSAKTINELKTFLPRAASFGNP
VDILGDADEEKYAMTLKTVLDDEKVDGVVAVYGKTAVIDMEKMVQAVINGRRKNPDKPVV
ACFLGGVDSRRAKELLNKNKIPFYSFPEAAADALAVLYRYYSWREKQKEGKTEFSFDDID
RKLAREIIKNALVEGRRNLTGYETAEVLKAFGFPVLPVKLVRNVQELRKAIEEISFPLAL
KIVSPDLLHKSDVGGVALNIKNEQEAIRAYQKMILEVPKKVPEAKILGVEVQKQIAPGLE
IFIGANRDPVFGPILAFGLGGIYVNLLNDIALRLNYKFTREEALEMIKETKVYEIIKGYR
GQKAYDLKIIQEILGRLSLFLEEIPEIKEIDFNPVFVYEKGALIIDAKVVLAGHNI

BLAST