GenomeNet

>chy:CHY_2211 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) type II restriction endonuclease (A)
MLYLNLQKDELADLFVRSLLETNRAFNFYVNWKNVEEYKKFDIELNAMNVLIRNEDFDNT
FKRLLKKMPTVVATFPYLFALSKAEREKTWNGTEKLLIINDKIGESDILEYDFSLKTLKK
GLSDEQIENYLYFFEKMGLKHLFLNLAQNNIIDYVIGVLVGLDSNGRKNRGGHAFELACY
PIIRDLCDKYEIILIEQKQFKVLKEEYGFEISDNISERKADFILLKDKKCLNIEVNFFGG
AGSKPEEIIDSYINRQRDLKENNIDFAFITDGKKCWGNSTKPQLQKAFREIKYFMNFFLA
KEGMLEEVIKEIFKL

BLAST