GenomeNet

>cim:CIMG_00441 hypothetical protein; K06101 histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43] (A)
MARDPMLSPSSTPTSSALDSDATAIDATVPVLTPATSISEQSTPVDTEKDGEHRAKKAKA
SRRVTRSSLKNGELEANGGGEAMVTRPNDESLDNTNTQEDEDCTSLLNGAEDASGSVDKW
SSKNAEAAGKKPNKKAGNKSPKRRSTRLSLLAKTMDLAQSAPSVLGKRTLDAISKSKDKV
KTIDRKASLRPRVENEKKEASTPAPQEPSPKKRRVSGDNKSTCQVPRQEQTATRENSLIR
QKRKPWLKHGLYAGQEYIDSSVPKSKRGTRDAKNNGQQSQVFPFPMYAGARLLENGRAYK
LPFDIFSPLPHGQPKPNEWRKANKNVFVGDAASIWKAAKIKEHSTCTCTPETGCDENCQN
RYMFYECDDTNCKLGSELCRNRPFSALRRRAKAGGKFNIGVEVIKTEDRGYGVRSNRSFD
PNQIIVEYTGEILTQEECERRMRTVYKKNECYYLMYFDQNMVIDATRGSIARFINHSCEP
NCRMEKWTVAGKPRMALFAGEDGIMTGEELTYDYNFDPYSQKNVQECRCGAPTCRGVLGP
RPKESWKNKDKEKKSAPAAKRKVDSALDESASRLNKKPKPSRASSLKTGIKKAVSKARTA
LKSTQTKGKVKRVGRPAKKAVSIKPIPVKKRRSTLTRAKMPVKSASKSAEGDEKPPRNKG
RKLKMPSKPRLGNSIAAARASNKTPALMRKFLEAGDTKGGAKVVSDTIKPGRKTRAARTA
DVRSSPDNVPVSRKRGRAKKTS

BLAST