GenomeNet

>cim:CIMG_02339 succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial precursor; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MSFNGLRSLAPATRFSRSLRDQRRLFSSSRPAARIITSQPLRAKEASPFLTKKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGKIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLMENGECKGILAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGEV
LTIDEKGNDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNATPNTP
HKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVRKIN
EVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDANWMKHTLTFQKEPHGKVDLTYRAVTQTTLDESECKPVPPFKRVY

BLAST