GenomeNet

>cim:CIMG_02339 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial (A)
MSFNGLRSLAPATRFSRSLRDQRRLFSSSRPAARIITSQPLRAKEASPFLTKKYPVIDHE
YDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGKIYQRAFGGQSKEFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRYNASYFIEYFALDLLMENGECKGILAYNQED
GTLHRFKAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSNGERFMERYASTAKDLASRDVVSRSMTLEIREGRGVGPEK
DHIYLQLSHLPPEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGEV
LTIDEKGNDKIVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNATPNTP
HKEISADAGAESIEVLDKIRTADGPKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVRKIN
EVDQMFAQVGTKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDR
DDANWMKHTLTFQKEPHGKVDLTYRAVTQTTLDESECKPVPPFKRVY

BLAST