GenomeNet

>cim:CIMG_03802 hypothetical protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MERADEVRNLLNPVQERILQFIQSADRGSKAIIAHDPSDESDPLFSGLLNLKRPSELQQE
LQVDFPGSGQGADGLLQILDRILQYSVNTWHQGFLDKLYASTNAPGLAAELIIAALNTNV
HVYQVAPALTVIEKSTAARLASLFGLNGPYAGGIAVQGGTASNTTAIVIARNTLFPETKT
EGVSGNQFVLFSSAHGHYSIEKAAQMLGFGSKAVWVVPVDEKGQMIPKALDDLIITAKSQ
GKKPFFVNATAGTTVVGSFDPLPEISEICRKHNLWFHVDGSWGGSFIFSSKQKSKLTGSH
LADSITFNPHKMLGVPVTCSFLLAADIRKFHRANTLPAGYLFHNEEYTKGFWDLGDLTLQ
CGRRADALKLFLSWMYYGSEGYEQKIDSACSVAEHLSTVVGNNPHLILLTENPPPCLQVC
FYYAPLGRMAYPPGREINGKTLSEEERAELNSQITEEIVQKLVPQGFMVDYAPPSDGDTF
AKDGKFFRCVVNVLTKEETVDSLVNTIVKLGSTIVKRRLGSELNIPTPTAHPAPTSGFRP
KNPAERGHGPVVFE

BLAST