GenomeNet

>cim:CIMG_08649 hypothetical protein; K11484 histone deacetylase HOS3 [EC:3.5.1.98] (A)
MAPKQHAGSSGRQSTLTTNNEREQLVSSFNQLSLAPQAALPRQSPSRTSSQSYRTLDKPQ
QAQHDALAHRSPVPRRTPSINSLREDRRSSTPSLKKRLSTASLRSVQNSNGVGSPRPSTS
RRASHQFLSTPGSMMRPISPSVMSECPSPPPLPTASSIAAEHFEKELALHQSTDLRSKTV
VILQDACYGHRYSRPRTSKAGLESIVERPERLRAGILGVASAYVRMGKRWGNHRCAPHPD
LDLSSLPVPPFQILKTTRTLPLNSPAITHVHGAKWMGELKMMCDAAESRLALNGKELVRP
NSSGSDSSGSVPKLHEGDLYLCPESLNAFEGALGGVCEAIDTVFESDATRRAFVCIRPPG
HHCSSNFPSGFCWLNNVHVGIAHAAMTHGLTHAAIIDFDLHHGDGSQAIAWEQNQRAISA
SRNAPLHKKTRIGYFSLHDINSYPCESGDEAKVMSASVCIDNAHGQSVWNVHLEPWKDAM
EFWQLYNTKYAVLLDKARCFLRSCSQQLRDSPNSTHPKAAIFLSAGFDASEWEGIGMQRH
KVNVPTDFYAKFTSDINRLAEEEDLAVDGRIISVLEGGYSDRALTSGIFSHLSALADTRN
VVVDDMDAQSRLASEMFSRLNLSDKASNAPSCDSTEEPILFDTIWWTGPMLEELEIIAQK
PPPAPIRKLREKGQPSFLAHTQASAAKAVTPVRERGVLFSHHATLDEPFSLPEVDWALAA
VELSKAIIPTDRQTSSLKHADLKGENARSKRERHSLTGSTDLESVSERGHMQLRERKPKA
PVIPELQPGNSRSSSRSTRRTTIASSSDLADGALPETPIESLDQTQVVVPQHSRKLSVTS
SVASVGSAAPRNISLRKPREASSRPVSRAQASTRPATSMGINVQKQRAVGVGDRSGSRKS
TPLDTTSAQSQHGDVDHLSNGVKKLSLKLKVPTPEEHAAREAARIAEERNRNMSKTAKKT
PAAKPTKQIAGKSTSKTSRNATISEAPRAESDTADPRMIPLPSESTPVSSTEHSLAISAG
REQHQTTDHPSFPSPPLTPLSPCARPQTTVKSAPPKAYTKEDLPVFTSTSVIPFGPSRDS
NTGS

BLAST