GenomeNet

>cin:100181049 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) creatine kinase S-type, mitochondrial-like (A)
MLKPGSHPLRKLPFPPSADFPDLSKHHNIMKNHLTPGVYAQLRDRVTPNGITLDQCIQTG
VDNPGHPFIKIVGLVAGDEESYETFKELFYPVIKERHNGYDPETMVHPIDLDPSKLAGGK
LDEKYVLSSRVRTGRAIRGIPHPPMCSRAERREVERVVTDALQGLPKDLEGKYYSLKTMT
DKEQDQLIDDHFLFDKPVSPLLTSAGMARDWPDGRGIFHNDKKNFLVWINEEDHSRIISM
EKGGNMKSVFERFCRGINEVEKLIQEKGWEFQKSENLGYILTCPSNIGNGLRCGVHVKLP
KLSQEPKFNEILEKLRLQKRGTGGVDTAAVGGTFDISNLDRLGKSEVQLVQEVVDGVSLM
IDMEKKLEKRQSIQHLIPK

BLAST