GenomeNet

>cja:CJA_2421 K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] | (GenBank) eryB; NAD binding site:D-amino acid oxidase (A)
MKYDLVVIGAGIQGAGVAQAAAAAGYSVLVLEQTAPAAGTSSKSSKLIHGGLRYLESAQF
GLVRESLRERELLLKLAPDLVKLQPLHIPIYEHSVRSVFTIRAGLSLYSLLAGLNHHSRF
RQLPRREWDQLKGLRQDGLKAVFRYYEAQTDDAALTRAVLQSAVTLGAELQMPARFIAAH
RNGQRCRVEYEDARGSHAVSCRVLVNCAGPWVSQVLAGVDPALSAPGVELVQGSHLLLPP
LLDQYFYLEAPADKRAVFVLPWEGKLLVGTTEKIHQDIPEKSHCSQEEQDYLLATLRHYF
PHLHIDPQQVESFAGLRVLPRSDQQAFSRPREVMFEVDDPLRPRVLSIMGGKLTTYRATA
QMALARIKPSLPAKDKRADTAHLPLIPVH

BLAST