GenomeNet

>cja:CJA_2421 eryB; NAD binding site:D-amino acid oxidase; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MKYDLVVIGAGIQGAGVAQAAAAAGYSVLVLEQTAPAAGTSSKSSKLIHGGLRYLESAQF
GLVRESLRERELLLKLAPDLVKLQPLHIPIYEHSVRSVFTIRAGLSLYSLLAGLNHHSRF
RQLPRREWDQLKGLRQDGLKAVFRYYEAQTDDAALTRAVLQSAVTLGAELQMPARFIAAH
RNGQRCRVEYEDARGSHAVSCRVLVNCAGPWVSQVLAGVDPALSAPGVELVQGSHLLLPP
LLDQYFYLEAPADKRAVFVLPWEGKLLVGTTEKIHQDIPEKSHCSQEEQDYLLATLRHYF
PHLHIDPQQVESFAGLRVLPRSDQQAFSRPREVMFEVDDPLRPRVLSIMGGKLTTYRATA
QMALARIKPSLPAKDKRADTAHLPLIPVH

BLAST