GenomeNet

>cjj:CJJ81176_0584 pyridine nucleotide-disulphide oxidoreductase family protein; K00384 thioredoxin reductase (NADPH) [EC:1.8.1.9] (A)
MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQFYKDGKRVDKAYKGCE
GTNHGHVPFEDGTKESTIETFQNALKEHNIEVEFGSEVESVKNENGVFLVSTAKGVYECK
NIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLGNEKILVVGGGNSAAEYAVDLANSN
QVSLCYRKKEFTRLNDINLKDIHEARNSGKVELKLGIDINEVEDDNGKAKVNFTDGTSDI
YDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVKGIFVAGDIATKNGASIVTG
LNDAVKILSVL

BLAST