GenomeNet

>cju:C8J_1331 K01841 phosphoenolpyruvate phosphomutase [EC:5.4.2.9] | (GenBank) hypothetical protein (A)
MIIEDKIGLKKNSLLGNDVIQNQDSIEDFCSKIQAGKKAQITNEFMIIARIESLILDKGM
DDALQRAFAYIQAGADGIMIHSRHKDGDEIIDFLKQFRLKDQDTPIVVVPTSFNEIKASD
LATYGANIIIYANHMLRASFVAMQNVAKEILENDRSKESESKCMKINEILNLIPGTV

BLAST