GenomeNet

>ckl:CKL_0538 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) tgl; Tgl (A)
MIKISNSNFDINSIIAQYKDNSIERYILNELSSSSQTYYYNSLEELKFELDLRKNIVDAS
VRLSMSKFRFRTFRKSICNPEYWERTKQGGFLLKKGVRASAAIDDIYKNSSKYGTECATA
IVIVYYKGCLSSFREKIFDSTFKHIYLMDWQNTDENLSLDVIIDVDVYLPGDCRYFKNPE
VNPITPEWQGENVIVLGNGKYYGHGIGIKTADEIITALNKRRIIGATHSAYLLDSVTRPN
FKQLADIYFNASSRTDKVSSVKTSQTW

BLAST