GenomeNet

>cko:CKO_01194 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) hypothetical protein (A)
MTRPILASLDLQAMKQNLGIVRQAAPDARVWSVVKANAYGHGIERIWTALGATDGFAMLN
LEEAITLRERGWKGPILMLEGFFHADELAIYDTYRLTTCIHSNWQLKVLQNARLNAPLDV
YLKVNSGMNRLGFLPERVQTVWQQLRALPNVGEMTLMSHFADAEHPEGIDQAMTKIAHAT
EGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTGLKPVMTLSSQII
GVQTLKAGDRVGYGGRYTATQEQRIGIVAAGYADGYPRHAPNGTPVLVDGVRTGTVGTVS
MDMLAVDLTPCPQAGIGTSVELWGKEIKIDDVASAAGTVGYELMCALAPRVPVVTA

BLAST