GenomeNet

>cko:CKO_01317 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) hypothetical protein (A)
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNSSLFEEIRTENAQQTIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFGGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQAGRPYNEGEQVVIGGNERYVS
VCRKHYKEALAEGSLTSIQEKHRHA

BLAST