GenomeNet

>cko:CKO_01658 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (GenBank) hypothetical protein (A)
MKRLSLAMLTLLACAGAQAASEEVTMNLVTSQGVGQSIGSVTIAETDKGLEFTPDLKALP
PGEHGFHIHANGSCQPAIKEGKASAAEAAGGHFDPHNTGKHEGPEGAGHMGDLPVLVVNN
DGIATTPVTAPRLKSLDEIKDKALMIHVGGDNMSDQPKPLGGGGERYACGVIK

BLAST