GenomeNet

>cko:CKO_03854 hypothetical protein; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MENTTSPDALLNADNASWLEEHYRTWLRSPEMVPEDWRRFFLTEEFLSDDSAATSNVTGT
TIKKQAAVTQLIQAWRNLGHLRAKLDPLDMMQPPDVPQLTPAFWGLTAEDLNQEFSAAFG
GRHTQMPLKQIIAMLEQAWAGSCAYELAHLDNSDEIAWLLERIERGNVPAPDAQTCMLRF
EKLVAAETLERYLHTRYVGQKRFSLEGGESAISALNTLALHVREQGVDELVIGMAHRGRL
NVLVNLLGKDPAQLFAEFEGKQAIGEGSGDVKYHMGYSCNMQTPVGALHIALAYNPSHLE
IVNPVVLGQVRARQNRRGEKGQTKVMGVLIHGDSALGGLGVNQATFNLSQTRGYGTGGTI
HLVINNQVGFTTSHLQDMRSSRYCTDIAKMAAAPVIHVNGDDVDAVCEAITLACDWRNIF
HRDIIVDLVCFRKLGHNESDEPRLTQPQMYQAVDSHPGMRTRYGDALIQRGVLTPAQQEQ
KINEYRDWLDACQKRDPLPTPDSTHPFSANWDGLTNPQWSVQPETGLSCEELSYYGNIIT
TLPDEVTAHPTLKRQLALRKEMTAGVQPVDWGMAEMLAYASLVDNGFGVRLSGEDSGRGT
FSHRHAVVHNQAQAGCWLPLQHIREGQAPFEVFDSVLNEEAMLAWEYGYSTSAPQQLVIW
EAQFGDFANGAQVAIDQFISSGETKWGRYSGLTILLPHGYDGQGPEHSSARPERWLQLCA
EHNMHVVVPGESAQMFHLLRGQVLRSARKPLVVFVSKRLLRFKGAMSELSQFSAGMFRPV
ITDAYPHDPALVKQVILCSGQVYYDALDARKQRGLEDSVAIVRVEQLYPFPTDELNAALA
QWRHCPHWVWLQEEPENQGAWRQIRHELASLTLENPDWRYAGRPAAAAPATGYGRVHKQQ
IDDFLADAFAPVQP

BLAST