GenomeNet

>cko:CKO_05029 hypothetical protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MKLTAFALALMPGIVFASSWTSQGFPPFTAEGTGKFVSHAALTKGTRPLSLHIDQQCWQP
ADAIKLNQMLSLKPCEGTPPQWRLFKDGDYSLEIDTRSGTPTLTLSIKSTADPVASTVRQ
CPTWNGSPLTLEVSHTFPEGAVVRDYYSQQTATVKNGQITLQPGATSNGLLLLERAETDT
PAAFNWHNATVYFVLTDRFQNGDPTNDQSYGRHKDGMEEIGTFHGGDLRGLANKLDYLQH
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEGDLRALVDGA
HQRGIRILFDVVMNHTGYATLADMQTFRFGALYLQGDELKKTLGERWTDWKPAAGQSWHS
FNDYINFSDKAAWEAWWGKEWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTPSGLPVF
YKNKPDTRAKAIEGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTQASAA
LTEWKQANPDKTLDDTPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAN
MDATWQQMAEKLQDFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESARPFG
PTGSDPLQGARSDMNWQDINGKSAATVAHWQRISQFRARHPAIGAGKQTTLSLKQGYGFV
REHDDDKVMVVWAGRP

BLAST