GenomeNet

>ckr:CKR_0475 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (GenBank) hypothetical protein (A)
MIKISNSNFDINSIIAQYKDNSIERYILNELSSSSQTYYYNSLEELKFELDLRKNIVDAS
VRLSMSKFRFRTFRKSICNPEYWERTKQGGFLLKKGVRASAAIDDIYKNSSKYGTECATA
IVIVYYKGCLSSFREKIFDSTFKHIYLMDWQNTDENLSLDVIIDVDVYLPGDCRYFKNPE
VNPITPEWQGENVIVLGNGKYYGHGIGIKTADEIITALNKRRIIGATHSAYLLDSVTRPN
FKQLADIYFNASSRTDKVSSVKTSQTW

BLAST