GenomeNet

>ckr:CKR_1808 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (GenBank) hypothetical protein (A)
MNYENYKQYLSPALAKATDLIMESGKGCYMTDINGDEYLDFVQGIAVNALGHCHPKVVQA
VVEQTKKLMNGSFNLVNFPTTLKLAKRLSEVTPGNLNSIFFSNGGAEAIDGALKLAKAYT
KRPAIIAFKGSFHGRTLGATTITASNSKYRKYYEPMVGSVYFSTYPSKDLCPKGFDEKQR
TEYCLNELDSLFKYVVAPEMVAAIIMEPVQGEGGYVVPTKEFVQGVRDICTKHGILLIFD
EIQSGYGRTGKMFAGENFDVVPDIMTVGKAIAGGLPMSAVISTPEIMDEWHAGMHGTTFG
GNPVCAAAALAVLEEYKNANILENVNNMGAYLRKKLEVLKEKYSCISDIRGLGLMVAIEF
SYGDGTPAGDLFEKVRDKCFKNKLLTLACGVYGNGLRFAAPLNVTEDEIDKGITIIDKVL
GEIWKK

BLAST