GenomeNet

>clb:Clo1100_0393 ATP dependent DNA ligase-like protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MNWIIPMEPVICPDVKEGSGCIHEIKWDGIRGMVYIQDGNVKIYTKKGKERTGFYPELDV
LRKGLGGKNAILDGEFVVLDEDGVPSFYKSLIRERVRNSGKLQYYTSSYPVCYMVFDILQ
YGDDILVNMPLIERKQILEENLSSLTGNDTKIFLAKMYKDGKELFEKMKKQNMEGIVSKK
TDSLYIGGKKHDAWFKTKFIKKMLCIVGGIQWKSIHPNSLVLGIKPPDSEKLVYVGKASI
GLKQSDLMLIKEYSGQLEQEECPFTTDEIIQLDKTGEKFTWLYPALTCWISFLELTNDGH
LRHPKIEGFAVLPVEEADGKVLTD

BLAST