GenomeNet

>clb:Clo1100_0393 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP dependent DNA ligase-like protein,ATP dependent DNA ligase family protein (A)
MNWIIPMEPVICPDVKEGSGCIHEIKWDGIRGMVYIQDGNVKIYTKKGKERTGFYPELDV
LRKGLGGKNAILDGEFVVLDEDGVPSFYKSLIRERVRNSGKLQYYTSSYPVCYMVFDILQ
YGDDILVNMPLIERKQILEENLSSLTGNDTKIFLAKMYKDGKELFEKMKKQNMEGIVSKK
TDSLYIGGKKHDAWFKTKFIKKMLCIVGGIQWKSIHPNSLVLGIKPPDSEKLVYVGKASI
GLKQSDLMLIKEYSGQLEQEECPFTTDEIIQLDKTGEKFTWLYPALTCWISFLELTNDGH
LRHPKIEGFAVLPVEEADGKVLTD

BLAST