GenomeNet

>clc:Calla_1720 pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein; K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MAIRDRLSGNEAIAFAMKQINPDVVAAFPITPSTEVPQYFSQYVANGEVDTEFVAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDELVKKFVGEYNPEFYLLNEQNPISMGPLDLPPYYFEHKRQQAEAMRNAKKVVLEIA
EEFAALTGRKYGLFEAYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVDEIVGALKHLKAVAIMDKSDGFNAAGGPLFTEITSALYGRADGIKAINYIYGLGGRD
VKTDDIAKVYDRLLDIVKTGNVGEVYNYIGVRE

BLAST