GenomeNet

>clu:CLUG_05128 hypothetical protein; K00026 malate dehydrogenase [EC:1.1.1.37] (A)
MVKVTVCGAAGGIGQPLSMLLKLNPRVSRLALYDIVNAVGVAADLSHINTPAVVTGHQPA
AKNDSSALVEALQDSDIVVIPAGVPRKPGMSRADLFNINASIVRDLVAHAGRTCPNAAIL
IISNPVNATVAIAAAVLKKLGVFNPRKLFGVTTLDSVRAETFLAQILDVPPASLRGKISV
VGGHSGDTIVPLVHFDRALESKMKTVSASDYANFVHRVQYGGDEVVKAKIGAGSATLSMA
YAGYRFASNVLASLVDAAEYSAVPDSAYIYLDGAAGGAEIATTLQDTPFFSVPVHLKKGE
VSSVVDPWHLVRTHEEKKMIAVALEGLEKSVSQGTNFVEGSKI

BLAST