GenomeNet

>clu:CLUG_05128 K00026 malate dehydrogenase [EC:1.1.1.37] | (RefSeq) hypothetical protein (A)
MVKVTVCGAAGGIGQPLSMLLKLNPRVSRLALYDIVNAVGVAADLSHINTPAVVTGHQPA
AKNDSSALVEALQDSDIVVIPAGVPRKPGMSRADLFNINASIVRDLVAHAGRTCPNAAIL
IISNPVNATVAIAAAVLKKLGVFNPRKLFGVTTLDSVRAETFLAQILDVPPASLRGKISV
VGGHSGDTIVPLVHFDRALESKMKTVSASDYANFVHRVQYGGDEVVKAKIGAGSATLSMA
YAGYRFASNVLASLVDAAEYSAVPDSAYIYLDGAAGGAEIATTLQDTPFFSVPVHLKKGE
VSSVVDPWHLVRTHEEKKMIAVALEGLEKSVSQGTNFVEGSKI

BLAST