GenomeNet

>clv:102098736 K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] | (RefSeq) F13A1; coagulation factor XIII A chain isoform X1 (A)
MSETMNTNEERKPPLNGRRALPSNNSNEEENEVPEMEAFGLIPRGFNPKDYLRVVDIQMF
KEPHEINKQQHHTDKYYSPKLIVRRGQLFQIQVDFNRPYNPETDQFWLEYLIGRYPQQNK
GTYIPILVGDVLKPGEWGAKITHKENNSVRLSIMSSATCIVGKFRLYVAVWTPFGILRTR
RNSATDTYILFNPWCQQDAVYMDDEKEREEYVLNDVGIVFHGNINDIKLRSWSYGQFEEN
ILDACLFLMDKAELELSGRGNPIKICRVASAVINSKDDNGVIAGSWDNTYTYGVAPSAWT
GSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLITNYSSAHDNNANLRLDFF
LDDEGKVDTKLTKDSIWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPAS
VQAIKHGHVCFQFDAPFVYAEVNSDIVYSRREKNGTQVIEKIDTTHVGQLIVTKEVGGDG
MMEITEDYKFQEGSKEERLALETAVMYGVKKQTTQDIVYQPQTDVDMDFQVQKAVIGSDF
KVTITFRNKSRNHYTATTYLSGNIVFYTGVTKNEFKXXXXXXQNWHPLHRALLML

BLAST