GenomeNet

>cly:Celly_1802 glycoside hydrolase family protein; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MRHGLTIALLFFIVAQSVTAQNDWENEHIFGINKMEARVASYSYKNSTDALEGDRNKARV
KSLNGIWKFKYTAKSTDRPTDFYAANFKGEDFANIPVPSNWELQGHGQPIYTNITYPFTP
NIQDPNLKYGWRGPQPPIPPKIYRDNPVGSYYRDFKIPEEWKNQSVILHFGGISSAFYVW
VNGKKVGYSQDSRLAAEFDISAYINPNTTNRVAVQVFRWSDGSYLENQDMWRLSGIHREV
LLLAQPKIAINDFYIKTKFDANIEDAKLQIRPKVWIKENKTNLQNWTITAMLFNADKKEV
LDKEISVPVSTVFNERWPARDITKFGLLEANIRMPNKWSAENPYLYTVVLNVKDPNGKIV
ESRSQKIGFRKVEFSKKNELLINGKVVKLMGVNRHDHHPTRGKALTREDLRKDVALIKQY
NFNAVRTSHYPNDPYFIELCNEYGIYVMSEANIETHHLGSYIPQTPSWTAPILSRVYRMV
ERDKNNPSIISWSLGNESGTGPAFAAAAAWIKDYDSSRFIHYEGAQGAPNNPAYIENAGF
TSNNWPSMANPTDPAYVDVISRMYPDHEQLINLANSPHINRPIVMCEYMHAMGNSMGGLG
EFWDIIRAKPNLIGGFIWDMVDQGLEKKDPNGNIFYAYGGDFGDVPNDHNFCINGVFASD
RTPNPHAWEAKYVFQPVAFEAVDLANKKVRIINRFTTTNLDKYTIKWSVFENGKELESGE
LDSQDIAASSSAIVTIPFKSNNLKSNSDYWLRLSAHEKTDRLWAKKGYLIAKEQLNIKTK
KATSTYTSSSNNHITTLETDKTITVKGTKFSVSISKENGQLASYKTEGKEQVISPLKPNF
YRPPVDNDIRGASNKVLKKGRQFWKNIIDSVKTTKVTISKKHEKFIEITSEQYISKKLSF
KTSFTVYNDATVLISFSTQASKSLPAPIRIGLTMGVSKQLKNTSYYGNGPYENYSDRKRN
SEIGEYHTKTDAMFTNYVMPQENGNRTETRWLKLTNNKKSGIAIIAMSEFSFSVWPYSSE
NIEQAKHPYELTPQNYYTLNIDYAQTGLGGTLSHLLPKYTLKSGEYNFQFLIQPLQ

BLAST