GenomeNet

>cmc:CMN_00341 ppcA; hypothetical protein (EC:4.1.1.31); K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MTTPPKKPLPLEHDSTRDGTRDAVEPALRSDVSHLGGLLGQVLRESGGDDLLRDVERLRE
LVIDAYESARDASIDDAERLVATFTPERAEQVARAFTCYFHLANLAEEHHRVRVLREREA
ASGFVPDSIPDAVGKLTEELGREEAMRRLGEMRFHPVLTAHPTEARRRAVATGIRRIGDL
LTERDGAMAGTLTGQDVDRRLLEEIDGLWRTSPLRTTRPTPLDEVRTAMGVFDQTLFEVV
PRVYRLLDDWLLGDEAGARDAVAPAFFRLGNWIAADRDGNPYVTAAVTEEAAGIASEHIL
LGLERVALRVGRSLTLGDADTPPSAELRELAAAQDALAPHLTARIGTRAPAELHRRVLLV
IAGRLAATRERHDDPIAYPSAAELLADLRVLQASLRSAGAHRIAGGELQGLVWQAETFGF
HLAEMEVRQHSQVHREALREVLAVASADASGEQAPELAPMTVEVLDVFRTLARLQQRHGV
APFSRFIVSFTQSADDIRTVHELAALALGSAEEAPVLDVIPLFETFADLNASTEILDGMI
RLPQVAARLAQTGRKLEVMLGYSDSSKDVGPVSATFALFDAQARIAAWARENDIELTLFH
GRGGALGRGGGPADRAVRAQPPGSVDGRFKLTEQGEVIFAHYGDKRIAARHIEQMAAATL
LASAPSNEERNAAAAHGSADMVRTMDEASRARFFELVKAPGFAPWFAQVTPMEEIGLLAL
GSRPARRGLSVESLEDLRAIPWVFAWTQARINLTGWFGLGSALAAVGDEDVLRKAYDEWP
LFTSMIDNVEMSLAKTDGRLAERYLALGDRPDLAALVTEEMELTREWVRKATGRGEILEG
RPVLRRAVRLRSPYVDALSLLQLRALRALRTAASDATGQAAPGQADPTDPDHRLLLLTVN
GIAAGLQNTG

BLAST