GenomeNet

>cmi:CMM_0383 ppcA; hypothetical protein; K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] (A)
MTTPPKKPLPLEHDSTRDGTRDAVEPALRSDVSHLGGLLGQVLRESGGDDLLRDVERLRE
LVIDAYESARDASIDDAERLVATFTPERAEQVARAFTCYFHLANLAEEHHRVRVLREREA
AAGFVPDSIPDAVGKLTEELGREEAMRRLGEMRFHPVLTAHPTEARRRAVATGIRRIGDL
LTERDGAMAGTLTGADVDRRLLEEIDGLWRTTPLRTTRPTPLDEVRTAMGVFDQTLFEVV
PRVYRLLDDWLLGDEAGVRDAVAPAFFRLGNWIAADRDGNPYVTAAVTEEAAGIASEHIL
LGLERVALRVGRSLTLGDADTPPSAELRELAAAQDALAPHLTARIGTRAPAELHRRVLLV
IAGRLSATRERHDDPIAYPSAAELLADLRVLQASLRSAGAHRIAGGELQGLVWQAETFGF
HLAEMEVRQHSQVHREALREVLAVAAADASGDQAPELAPMTVEVLDVFRTLARLQERHGV
APFSRFIVSFTQSADDIRTVHELAALALGSAEAAPVLDVIPLFETFADLNASTEILDGMI
RLPQVAARLAQTGRKLEVMLGYSDSSKDVGPVSATFALFDAQARIAAWARENDIELTLFH
GRGGALGRGGGPADRAVRAQPPGSVDGRFKLTEQGEVIFAHYGDKRIAARHIEQMAAATL
LASAPSNEERNAVAAEGSAEMVRTMDEASRARFFELVKAPGFAPWFAQVTPMEEIGLLAL
GSRPARRGLSVESLEDLRAIPWVFAWTQARINLTGWFGLGSALAAVGDEAVLRKAYEEWP
LFTSMIDNVEMSLAKTDGRLAERYLALGDRPDLAALVTEEMERTREWVRKATGRGEILEG
RPVLRRAVRLRSPYVDALSLLQLRALRALRTSASEAAGQGAPGQADPTDPDHRLLLLTVN
GIAAGLQNTG

BLAST