GenomeNet

>cmi:CMM_1745 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) sodA; superoxide dismutase [Mn/Fe] (YP_062104.1| superoxide dismutase [Leifsonia xyli subsp. xyli str. CTCB07]; ZP_00198450.2| COG0605: Superoxide dismutase [Kineococcus radiotolerans SRS30216])., pfam00081,Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain., pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain., InterPro: Manganese and iron superoxide dismutase (SODM); High confidence in function and specificity (A)
MADYTLVDLPYDYSALEPSISGRIMELHHDKHHKTYVDGANTALVKLQEARDAGDLTFVN
KLQKDLAFNLAGHVNHTVFWNNLSPDGGDKPTGELAAAIDEFFGSYDKFQAHFTASALGI
QGSGWSILAWDSLGQKLIIEQLYDHQGNLAAATVPILLLDMWEHAFYLDYVNVKADYVKA
FWNIVNWADVQARFDAARTKTQGLFLLS

BLAST