GenomeNet

>cml:BN424_358 azlD; branched-chain amino acid transport family protein (A)
MNNQLILLILGMAFVSYLPRVIPMMYFSKREIPQWFHDWMKYVPAALFAALFFKDVFIVD
HSFSLITNIKVLAAVLVMIVAYKTKSMGLSVVAGLGSLLLLNYLM

BLAST