GenomeNet

>cml:BN424_709 hypothetical protein (A)
MKKRMKFIGMSAAVLLALSPVVMPAIGATSTVVYADESYDGILKNAIQSNYTVEDWTAER
ILGLKTLVNSGATNQLYTGSITNNSFYTDILSSKIFNNQTLNQILGVAGASAKAQILVDG
KSQVTEADLSKAQLTLTVKIFATNGKTAEAEVLLKTNAPELAVNDEMLSLTQAFGADYVD
FELNPELLTVANNDSNGSWSVDTVVSVTPTKERLVRDGILDSEGRYIKAGEYTQTITASL
ISTTGTEVLRTIDVTISVLAPNAADLKFIAKTADAKEYANGSTVLQTAIENMDATVAATS
PYKFEDNLILNSPVFFNFDTKVTNYGELDEVLKNRFIELFQVSNEISGTVATLPIQIDKL
TVDSTSIDFSKAGIATVPFKYTTPNGQEMTLSLQLKMKNPGNPVFEFSQNQDITISIGNA
FNLYDFKVYPNTNDLNNGNAAGNEGIGLLGGVTINGSVNTSKVGVYKITYTATNLNHLTT
TLVRTINVIDPNEGNEKPEITNFKSVGYVDYITGYGIRVWGTPKGNGSSQFLPHATAWKI
DQKATFKNGDIWYRVGKDHWVDGSYIKFSPVANDPGMNELKGVGTINYVPGYSINVYKGA
EASSANWTGKQLEHGTKWRVYGEKNGFYNLGGNQWVASNYVTFIKD

BLAST