GenomeNet

>cml:BN424_810 K02003 putative ABC transport system ATP-binding protein | (GenBank) vex; ABC transporter family protein (A)
MITAKNVGYWYDKGNIPLYQHVNLTFEKGVLYSILGSSGSGKTTFLSLLAGLEKPKEGDI
LYEGTSISKMGLTKFRNQKVSIVFQAYNLLPYMTALQNIVTAMEITRSKETDKKAYALKM
LKKVGISEDLANKNVMKLSGGQQQRIAIVRAMCTDTELIVADEPTGNLDEETSRDIIHLF
QELAHKENKCIILVTHEKEVANESDVCIQLKNKEFTTII

BLAST