GenomeNet

>cml:BN424_810 vex; ABC transporter family protein (EC:3.6.3.-); K02003 putative ABC transport system ATP-binding protein (A)
MITAKNVGYWYDKGNIPLYQHVNLTFEKGVLYSILGSSGSGKTTFLSLLAGLEKPKEGDI
LYEGTSISKMGLTKFRNQKVSIVFQAYNLLPYMTALQNIVTAMEITRSKETDKKAYALKM
LKKVGISEDLANKNVMKLSGGQQQRIAIVRAMCTDTELIVADEPTGNLDEETSRDIIHLF
QELAHKENKCIILVTHEKEVANESDVCIQLKNKEFTTII

BLAST