GenomeNet

>cmp:Cha6605_3728 ATP-grasp enzyme, D-alanine-D-alanine ligase; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MKKKKLAVLFGGRSVEHEISVITALQLMNVIDVTQYEIIPVYIAQTGRWYVGDNLLFKSF
YRRLPNSLKEAQEVALLPVAGSKGLTYLNSRRNDILPVDIYFLAFHGTFGEDGCIQGMLE
MADATYTGCGVLPAALGMNKYQCKMMLKAAGIPVLPAALVDRRDAQKSLEAVREQILATP
GLEQLPLFVKPCNLGSSIGIGVAKDERTLNACLVNTFRYDSHAIVEPCVKDILEVNVSVL
EDDEITASVIEMPVSLSGVLTFEEKYLRDDGGKKTGGNESQGMASLSRIIDPQDLNPELK
QAALDYAKKAFKVLGCAGVSRIDFIIDASCDQLYFNEINTLPGSLSFYLWVKSNPPLVYT
ELLNRIIRQAEKRQVTKLALKRQEGMRALFK

BLAST