GenomeNet

>cmr:Cycma_3049 catalase related subgroup domain-containing protein; K03781 catalase [EC:1.11.1.6] (A)
MAEENKHNKLTTASGRIYVENENSKTVGPRGPILLEDYILHEKMAHFNRERIPERVVHAK
GSGAFGTFTVTNDISAYTKAKVFNKIGKKTKVFLRFSTVGGEKGSPDTERDPRGFAVKFY
TEDGNWDLVGNNTPVFFIKDPKKFSDFIHTQKRDPYTNCKSPTMMWDYWSLTPESLHQVL
ILMSDRGTPVGYRHMNGYGSHTFSMINAKNEKTYVKYHFKTAQGIKNLTDEEAAQMKAKD
LDFSQRDLVESIDKGDFPKWNMKIQVMTPEQAKKVDFNPFDLTKVWPHSEFPLIDVGVLE
LNQNPDNYFQDVEQSAFAPAHLVDGLGYSPDKMLQGRLLSYPDAHRYRLGGNYEQIPVNR
CPYAVNNYQRDGVMSVNGNGGRKPNYWPNSFDEVEVDKTYQEPSEQLEENIADWYDRNSK
LGGNDHYSQPRALFRDVMSKEEQDNTIKNTIGAMSGVSGPKRDLIINRQLCHWFRMDEEF
GARVAKGLGVDLNAVMSASSGSH

BLAST