GenomeNet

>cmr:Cycma_3049 K03781 catalase [EC:1.11.1.6] | (GenBank) Catalase related subgroup domain-containing protein (A)
MAEENKHNKLTTASGRIYVENENSKTVGPRGPILLEDYILHEKMAHFNRERIPERVVHAK
GSGAFGTFTVTNDISAYTKAKVFNKIGKKTKVFLRFSTVGGEKGSPDTERDPRGFAVKFY
TEDGNWDLVGNNTPVFFIKDPKKFSDFIHTQKRDPYTNCKSPTMMWDYWSLTPESLHQVL
ILMSDRGTPVGYRHMNGYGSHTFSMINAKNEKTYVKYHFKTAQGIKNLTDEEAAQMKAKD
LDFSQRDLVESIDKGDFPKWNMKIQVMTPEQAKKVDFNPFDLTKVWPHSEFPLIDVGVLE
LNQNPDNYFQDVEQSAFAPAHLVDGLGYSPDKMLQGRLLSYPDAHRYRLGGNYEQIPVNR
CPYAVNNYQRDGVMSVNGNGGRKPNYWPNSFDEVEVDKTYQEPSEQLEENIADWYDRNSK
LGGNDHYSQPRALFRDVMSKEEQDNTIKNTIGAMSGVSGPKRDLIINRQLCHWFRMDEEF
GARVAKGLGVDLNAVMSASSGSH

BLAST